PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g004027m
Common NameCISIN_1g001365mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CAMTA
Protein Properties Length: 779aa    MW: 87556 Da    PI: 5.0256
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g004027mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1180.61.8e-56201362118
               CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenpt 93 
                        ++ ++rwl++ ei++iL n++k++++ e++++p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+een++
  orange1.1g004027m  20 IEAQHRWLRPAEICEILRNYTKFRIAPESPHTPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENEN 111
                        5679**************************************************************************************** PP

               CG-1  94 fqrrcywlLeeelekivlvhylevk 118
                        fqrr+yw+Leeel++ivlvhy+evk
  orange1.1g004027m 112 FQRRSYWMLEEELSHIVLVHYREVK 136
                        **********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143783.03615141IPR005559CG-1 DNA-binding domain
SMARTSM010764.7E-7818136IPR005559CG-1 DNA-binding domain
PfamPF038591.2E-4921134IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.103.8E-5509597IPR013783Immunoglobulin-like fold
SuperFamilySSF812962.41E-17510596IPR014756Immunoglobulin E-set
PfamPF018332.1E-5510595IPR002909IPT domain
SuperFamilySSF484034.68E-10695763IPR020683Ankyrin repeat-containing domain
CDDcd002047.16E-7701763No hitNo description
Gene3DG3DSA:1.25.40.208.6E-9704763IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029710.63712758IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MADSRRFALG NQLDIEQILI EAQHRWLRPA EICEILRNYT KFRIAPESPH TPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSVDVLH CYYAHGEENE NFQRRSYWML  120
EEELSHIVLV HYREVKGNRT NFNRAKVAEG ATPYSQENEE TIPNSEVEGS QSSGFHPNSY  180
QMPSQTADTS LNSAQASEYE DAESVYNNQA SSRFHSFLDL QQPVAEKIDA GLADPYYPSS  240
LTNNYQGKFS VVPGADFISP AQTDKSRNSN DTGLTYEPQK NLDFPSWEDV LQNCSQGVGS  300
QPEALGDIPN QGYDILGEPF TNSFGERKEF GSHLQTRGEW QASRNDSSHL SNWPMDQKVY  360
LDSAHDLTSQ SCEQGAAHDG LLDSLRPPHA HPNMENDVHE QLPNAEHGHL LKSDPESSLT  420
IDGKSFYSSA IKQHLIDGST EGLKKLDSFN RWMSKELGDV KESNMQSSSG AYWETVESEN  480
GVDDSGVSPQ ARLDTYMMSP SLSQDQLYSI IDFSPNWAYV SSEVKVLITG RFLMSQQEAE  540
NCKWSCMFGE IEVPAEIVAG GVLRCHTSSQ KVGRVPFYVT CSNRLSCSEV REFEYRASHI  600
PDVDVADNCG DITSENLRMQ FGKLLCLTSV STPNYDPSNL SDISQLNSKI SSLLKDENDD  660
WDLMLKLTAE EKFSSEEVKE KLVQKLLKEK LQVWLVQKAA EGGKGPCVLD HCGQGVLHFA  720
AALGYDWALE PTTVAGVNIN FRDVNGWTAL HWAAYCGRPN TCRSGFFHWT QRNCWLSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.172300.0callus
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428204.10.0hypothetical protein CICLE_v10024764mg
RefseqXP_015382833.10.0PREDICTED: calmodulin-binding transcription activator 3 isoform X1
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLA0A067EMZ30.0A0A067EMZ3_CITSI; Uncharacterized protein
STRINGPOPTR_0007s05410.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1